puzzle picture
1792: Revisiting Puzzle 90: Heliomicin
Status: Closed

Summary

Name: 1792: Revisiting Puzzle 90: Heliomicin
Status: Closed
Created: 01/27/2020
Points: 100
Expired: 02/05/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Void Crushers9,841100
2Go Science9,81873
3Anthropic Dreams9,77552
4Beta Folders9,76436
5Marvin's bunch9,72924

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 16 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
mice in the attic
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons