puzzle picture
1789: Revisiting Puzzle 89: Cow Eye
Status: Closed

Summary

Name: 1789: Revisiting Puzzle 89: Cow Eye
Status: Closed
Created: 01/21/2020
Points: 100
Expired: 01/29/2020 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Hun-Magyar Csapat11,331100
2Go Science11,28974
3Contenders11,28754
4Anthropic Dreams11,28538
5Beta Folders11,25327

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 5 hours 32 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
I only have eyes for mooo...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons