puzzle picture
1774: Revisiting Puzzle 84: Giant Anemone
Status: Closed

Summary

Name: 1774: Revisiting Puzzle 84: Giant Anemone
Status: Closed
Created: 12/17/2019
Points: 100
Expired: 12/25/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,833100
2Gargleblasters9,79273
3Contenders9,78552
4Beta Folders9,77936
5Void Crushers9,73924

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Aubade01 172 104  9,833100
2ZeroLeak7 38 6 Go Science9,79996
3Enzyme 134 419 Gargleblasters9,79292
4crpainter 172 90 Contenders9,78588
5dcrwheeler 172 8  9,78085


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 4 hours 19 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
everybody loves a clown (fish)
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons