puzzle picture
1767: Electron Density: Kinesin Coiled-Coil
Status: Closed

Summary

Name: 1767: Electron Density: Kinesin Coiled-Coil
Status: Closed
Created: 12/02/2019
Points: 100
Expired: 12/09/2019 - 23:00
Difficulty: Advanced
Description: Fold a kinesin protein into an electron density map! We are giving you a monomer unit of the crystal structure 6IGN, which represents the coiled-coil stalk portion of a kinesin protein. Kinesins are motor proteins that transport cargo within the cell, by "walking" along the cellular cytoskeleton. This particular crystal structure of has a poor R-free value, meaning that some of the x-ray diffraction data is poorly explained by the crystallographer's structure. We are curious whether Foldit players can build a better structure into the electron density map!

Correct Sequence:
QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYD QKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,270100
2Go Science14,26874
3Beta Folders14,25554
4Void Crushers14,22538
5L'Alliance Francophone14,22127

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

frood66's picture
User offline. Last seen 11 hours 30 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
sequence

the above sequence given is not correct.

Aubade01's picture
User offline. Last seen 4 days 10 hours ago. Offline
Joined: 10/12/2013
Groups: None
Kinesin sequence

The sequence given is identical to the Ca Ion Binding Protein puzzle 1765
>>>>> Aubade00/01

beta_helix's picture
User offline. Last seen 1 day 11 hours ago. Offline
Joined: 05/09/2008
Groups: None
Nice catch!

Sorry about that, here is the correct sequence (updated in the description as well):

QLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDEL
NQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIG

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons