puzzle picture
1765: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed

Summary

Name: 1765: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed
Created: 11/26/2019
Points: 100
Expired: 12/04/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,819100
2Go Science10,78174
3Gargleblasters10,72054
4L'Alliance Francophone10,60538
5Anthropic Dreams10,55627

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Aubade01 78 43  10,835100
2LociOiling 3 1 Beta Folders10,81697
3ZeroLeak7 22 6 Go Science10,78193
4Enzyme 78 11 Gargleblasters10,72090
5Angus 24 40 Beta Folders10,65786


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons