puzzle picture
1762: Revisiting Puzzle 80: Calcium Channel Blocker
Status: Closed

Summary

Name: 1762: Revisiting Puzzle 80: Calcium Channel Blocker
Status: Closed
Created: 11/19/2019
Points: 100
Expired: 11/27/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Void Crushers10,346100
2Beta Folders10,30574
3Go Science10,21454
4Gargleblasters10,12638
5Hun-Magyar Csapat10,10127

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 54 min 42 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
yo, mamba
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons