puzzle picture
1757: Unsolved De-novo Freestyle 157
Status: Closed

Summary

Name: 1757: Unsolved De-novo Freestyle 157
Status: Closed
Created: 11/07/2019
Points: 100
Expired: 11/14/2019 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,024100
2Hun-Magyar Csapat10,02273
3Beta Folders9,98252
4Go Science9,86436
5Gargleblasters9,76724

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons