puzzle picture
1754: Unsolved De-novo Freestyle 156: Symmetric Trimer
Status: Closed

Summary

Name: 1754: Unsolved De-novo Freestyle 156: Symmetric Trimer
Status: Closed
Created: 10/31/2019
Points: 100
Expired: 11/07/2019 - 23:00
Difficulty: Intermediate
Description: This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD
Categories: Overall, Prediction, Symmetry

Top Groups

RankGroupScorePoints
1Go Science14,632100
2Gargleblasters14,53270
3Anthropic Dreams14,17547
4Beta Folders14,07730
5L'Alliance Francophone13,96919

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 9 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Looks like a "trimer", not a "dimer"

The puzzle description says "dimer", but the actual puzzle has a monomer plus two symmetric copies.

LociOiling's picture
User offline. Last seen 2 hours 9 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Also the link is bad...

The link says puzzle 1751, but it actually goes to the puzzle 1691 page. Puzzle 1751 is correct.

bkoep's picture
User offline. Last seen 3 hours 48 min ago. Offline
Joined: 11/15/2012
Groups: None
Thanks Loci!

We fixed the link to go the correct puzzle page.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons