Summary

Name:	1754: Unsolved De-novo Freestyle 156: Symmetric Trimer
Status:	Closed
Created:	10/31/2019
Points:	100
Expired:	11/07/2019 - 23:00
Difficulty:	Intermediate
Description:	This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric ~~dimer~~ trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Sequence: AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD
Categories:	Overall, Prediction, Symmetry

Top Groups

Rank	Group	Score	Points
1	Go Science	14,632	100
2	Gargleblasters	14,532	70
3	Anthropic Dreams	14,175	47
4	Beta Folders	14,077	30
5	L'Alliance Francophone	13,969	19

Rank	Player	Group	Score	Points
1	toshiue 15 52	Go Science	14,632	100
2	Phyx 16 6	Go Science	14,524	96
3	ManVsYard 7 74	Gargleblasters	14,514	92
4	NinjaGreg 9 17	Go Science	14,509	88
5	Bruno Kestemont 1 4	Go Science	14,461	84

Rank	Player	Group	Score	Points
1	ZeroLeak7 10 1	Go Science	14,559	100
2	Enzyme 69 7	Gargleblasters	14,532	96
3	Anfinsen_slept_here 11 25	Go Science	14,391	92
4	Galaxie 2 5	Anthropic Dreams	14,174	88
5	retiredmichael 14 3	Beta Folders	14,003	84

Need this puzzle? Log in to download.

Fri, 11/01/2019 - 03:54

Offline

Joined: 12/27/2012

Groups: Beta Folders

Looks like a "trimer", not a "dimer"

The puzzle description says "dimer", but the actual puzzle has a monomer plus two symmetric copies.

Fri, 11/01/2019 - 04:03

Offline

Joined: 12/27/2012

Groups: Beta Folders

Also the link is bad...

The link says puzzle 1751, but it actually goes to the puzzle 1691 page. Puzzle 1751 is correct.

Sun, 11/03/2019 - 20:47

Offline

Joined: 11/15/2012

Groups: None

Thanks Loci!

We fixed the link to go the correct puzzle page.

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics


	Top New Users felipecr Amitron SwedishSamurai kathy65 acarlson5