1754: Unsolved De-novo Freestyle 156: Symmetric Trimer

Status: Closed

Summary

Name:	1754: Unsolved De-novo Freestyle 156: Symmetric Trimer
Status:	Closed
Created:	10/31/2019
Points:	100
Expired:	11/07/2019 - 23:00
Difficulty:	Intermediate
Description:	This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric ~~dimer~~ trimer. In Puzzle 1751, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the protein might fold and bind to itself with C3 symmetry. Players may load in solutions from Puzzle 1751. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Sequence: AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD
Categories:	Overall, Prediction, Symmetry

Top Groups

Rank	Group	Score	Points
1	Go Science	14,632	100
2	Gargleblasters	14,532	70
3	Anthropic Dreams	14,175	47
4	Beta Folders	14,077	30
5	L'Alliance Francophone	13,969	19

Rank	Player	Group	Score	Points
1	toshiue 26 148	Go Science	14,632	100
2	Phyx 46 203	Go Science	14,524	96
3	ManVsYard 46 1002	Gargleblasters	14,514	92
4	NinjaGreg 25 19	Go Science	14,509	88
5	Bruno Kestemont 3 3	Go Science	14,461	84

Rank	Player	Group	Score	Points
1	ZeroLeak7 32 28	Go Science	14,559	100
2	Enzyme 46 188	Gargleblasters	14,532	96
3	Anfinsen_slept_here 14 35	Go Science	14,391	92
4	Galaxie 1 2	Anthropic Dreams	14,174	88
5	retiredmichael 46 1295	Beta Folders	14,003	84

Need this puzzle? Log in to download.

Fri, 11/01/2019 - 03:54

Offline

Joined: 12/27/2012

Groups: Anthropic Dreams

Looks like a "trimer", not a "dimer"

The puzzle description says "dimer", but the actual puzzle has a monomer plus two symmetric copies.

Fri, 11/01/2019 - 04:03

Offline

Joined: 12/27/2012

Groups: Anthropic Dreams

Also the link is bad...

The link says puzzle 1751, but it actually goes to the puzzle 1691 page. Puzzle 1751 is correct.

Sun, 11/03/2019 - 20:47

Offline

Joined: 11/15/2012

Groups: Foldit Staff

Thanks Loci!

We fixed the link to go the correct puzzle page.


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Forums temporarily locked due to spam Happy few Gold players in History Interview with DeepMind's Demis Hassabis timing for "share with scientists"? extend deadline for AlphaFold submissions?


	Top New Users Benjamin_F fracata Zhang Ruichong SonaKona B. A. Beder