![]() |
1754: Unsolved De-novo Freestyle 156: Symmetric Trimer
Status: Closed
|
Summary
Name: | 1754: Unsolved De-novo Freestyle 156: Symmetric Trimer |
---|---|
Status: | Closed |
Created: | 10/31/2019 |
Points: | 100 |
Expired: | 11/07/2019 - 23:00 |
Difficulty: | Intermediate |
Description: | This is a follow-up to Puzzle 1751: De-novo Freestyle 156, now with C3 symmetry. This protein was originally designed by a Foldit player as a symmetric Sequence: AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD |
Categories: | Overall, Prediction, Symmetry |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
The puzzle description says "dimer", but the actual puzzle has a monomer plus two symmetric copies.