Summary

Name:	1750: Revisiting Puzzle 75: Antifreeze Protein
Status:	Closed
Created:	10/22/2019
Points:	100
Expired:	10/30/2019 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,176	100
2	Void Crushers	10,143	73
3	Hun-Magyar Csapat	10,129	52
4	Anthropic Dreams	10,128	36
5	L'Alliance Francophone	10,116	24

Rank	Player	Group	Score	Points
1	Bruno Kestemont 1 4	Go Science	10,170	100
2	ZeroLeak7 10 1	Go Science	10,168	97
3	silent gene 4 8	Go Science	10,140	93
4	Galaxie 2 5	Anthropic Dreams	10,128	89
5	O Seki To 21 26	Hun-Magyar Csapat	10,124	85

Rank	Player	Group	Score	Points
1	Bruno Kestemont 1 4	Go Science	10,176	100
2	Timo van&n... 69 11	Void Crushers	10,143	97
3	O Seki To 21 26	Hun-Magyar Csapat	10,129	93
4	Galaxie 2 5	Anthropic Dreams	10,128	89
5	johnmitch 69 10		10,119	85

Need this puzzle? Log in to download.

Wed, 10/23/2019 - 19:32

Offline

Joined: 12/27/2012

Groups: Beta Folders

the pout pout fish

Fri, 11/01/2019 - 21:06

Offline

Joined: 03/30/2013

Groups: Go Science

Puzzle scores

This puzzle closed almost two days ago. No points are showing as having been awarded. Is anyone looking at this problem?

Fri, 11/01/2019 - 21:06

Offline

Joined: 03/30/2013

Groups: Go Science

Puzzle scores

This puzzle closed almost two days ago. No points are showing as having been awarded. Is anyone looking at this problem?

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics


	Top New Users felipecr Amitron SwedishSamurai kathy65 acarlson5