![]() |
1743: Revisiting Puzzle 73: Polycystein
Status: Closed
|
Summary
Name: | 1743: Revisiting Puzzle 73: Polycystein |
---|---|
Status: | Closed |
Created: | 10/09/2019 |
Points: | 100 |
Expired: | 10/16/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/73:_Polycystein