puzzle picture
1743: Revisiting Puzzle 73: Polycystein
Status: Closed

Summary

Name: 1743: Revisiting Puzzle 73: Polycystein
Status: Closed
Created: 10/09/2019
Points: 100
Expired: 10/16/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,709100
2Beta Folders10,70170
3Russian team10,57347
4Marvin's bunch10,51330
5Anthropic Dreams10,41619

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 4 hours 59 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
polycystein, not cysteine
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons