![]() |
1699: Revisiting Puzzle 60: Beta Barrel
Status: Closed
|
Summary
Name: | 1699: Revisiting Puzzle 60: Beta Barrel |
---|---|
Status: | Closed |
Created: | 07/15/2019 |
Points: | 100 |
Expired: | 07/22/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/60:_Beta_Barrel