Summary

Name:	1682: Revisiting Puzzle 52: Bacterial Energy
Status:	Closed
Created:	06/03/2019
Points:	100
Expired:	06/10/2019 - 18:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	11,527	100
2	Beta Folders	11,514	70
3	Anthropic Dreams	11,489	47
4	Marvin's bunch	11,436	30
5	Hun-Magyar Csapat	11,417	19

Rank	Player	Group	Score	Points
1	Bruno Kestemont 2 7	Go Science	11,527	100
2	toshiue 8 145	Go Science	11,527	97
3	LociOiling 9 5	Beta Folders	11,514	94
4	silent gene 7 13	Go Science	11,500	91
5	Galaxie 6 9	Anthropic Dreams	11,489	88

Rank	Player	Group	Score	Points
1	Bruno Kestemont 2 7	Go Science	11,512	100
2	LociOiling 9 5	Beta Folders	11,504	97
3	Phyx 63 37	Go Science	11,477	94
4	tyler0911 83 249	Anthropic Dreams	11,458	91
5	O Seki To 89 520	Hun-Magyar Csapat	11,417	88

Need this puzzle? Log in to download.

Tue, 06/04/2019 - 06:01

Offline

Joined: 12/27/2012

Groups: Beta Folders

it's back (teria)

This is the first puzzle in the revisiting series, presented out of sequence this time for some reason.


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Foldit Newsletters Preferred View Options How to Foldit Summary of Amino Acid Propensities for Secondary Structures (Alpha Helices, Beta Strands, & Beta Bends) Robust folding of a de novo designed ideal protein even with most of the core mutated to valine


	Top New Users LaplaceFox evickers29 Wiz kid dessurem Rimah Khatun