![]() |
1682: Revisiting Puzzle 52: Bacterial Energy
Status: Closed
|
Summary
Name: | 1682: Revisiting Puzzle 52: Bacterial Energy |
---|---|
Status: | Closed |
Created: | 06/03/2019 |
Points: | 100 |
Expired: | 06/10/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
This is the first puzzle in the revisiting series, presented out of sequence this time for some reason.
https://foldit.fandom.com/wiki/Revisiting_puzzle/Bacteria_Energy