puzzle picture
1674: Revisiting Puzzle 136: Cell Adhesion
Status: Closed

Summary

Name: 1674: Revisiting Puzzle 136: Cell Adhesion
Status: Closed
Created: 05/14/2019
Points: 100
Expired: 05/21/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1L'Alliance Francophone10,028100
2Gargleblasters9,93273
3Anthropic Dreams9,92452
4Beta Folders9,84336
5Hun-Magyar Csapat9,79824
Show all >

Top Evolvers

RankPlayerGroupScorePoints
1nicobul 61 1437 L'Alliance Francophone9,976100
2Blipperman 32 38 Gargleblasters9,93297
3Skippysk8s 33 37 Gargleblasters9,92391
4phi16 9 30 Anthropic Dreams9,92388
5ManVsYard 55 1040 Gargleblasters9,92285
Show all >

Top Soloists

RankPlayerGroupScorePoints
1jobo0502 75 22 L'Alliance Francophone10,028100
2Aubade01 75 21  9,99497
3actiasluna 75 1437 Gargleblasters9,92994
4tyler0911 63 1437 Anthropic Dreams9,92091
5robgee 7 8 Anthropic Dreams9,84785
Show all >


Need this puzzle? Log in to download.  

Comments

Tue, 05/14/2019 - 19:53
#1
LociOiling 2 1
LociOiling's picture
User offline. Last seen 1 hour 10 min ago. Offline
Joined: 12/27/2012
Groups: Anthropic Dreams
see also:

https://foldit.fandom.com/wiki/Revisiting_puzzle/Cell_Adhesion

Top
  • 0
Thu, 05/16/2019 - 17:27
#2
vakobo 75 727
vakobo's picture
User offline. Last seen 16 weeks 2 days ago. Offline
Joined: 06/05/2008
Groups: Russian team
crash

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

Top
  • 0
Sun, 05/19/2019 - 00:51
#3
 bkoep 75 288
bkoep's picture
User offline. Last seen 15 hours 25 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Yes, please!

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

Top
  • 0
Tue, 05/21/2019 - 15:46
#4
vakobo 75 727
vakobo's picture
User offline. Last seen 16 weeks 2 days ago. Offline
Joined: 06/05/2008
Groups: Russian team
Already shared

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.

Top
  • 0
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons