|
1670: Unsolved De-novo Freestyle 150: Symmetric Dimer
Status: Closed
|
Summary
| Name: | 1670: Unsolved De-novo Freestyle 150: Symmetric Dimer |
|---|---|
| Status: | Closed |
| Created: | 05/05/2019 |
| Points: | 100 |
| Expired: | 05/13/2019 - 23:00 |
| Difficulty: | Intermediate |
| Description: | This is a follow-up to Puzzle 1657: De-novo Freestyle 150, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1657, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1657. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence: NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY |
| Categories: | Overall, Prediction, Symmetry |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
my prior puzzle solution isn't showing up...