puzzle picture
1668: Revisiting Puzzle 134: Rice
Status: Closed

Summary

Name: 1668: Revisiting Puzzle 134: Rice
Status: Closed
Created: 04/29/2019
Points: 100
Expired: 05/07/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,696100
2Beta Folders10,54877
3Gargleblasters10,52058
4Go Science10,46443
5L'Alliance Francophone10,40531

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1tyler0911 117 4648 Anthropic Dreams10,670100
2johnmitch 117 20  10,55097
3LociOiling 8 3 Beta Folders10,54894
4Aubade01 117 55  10,54792
5Galaxie 3 5 Anthropic Dreams10,54689


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 10 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
LociOiling's picture
User offline. Last seen 1 hour 10 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
results
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons