![]() |
1663: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed
|
Summary
Name: | 1663: Revisiting Puzzle 125: Ice Binding Protein |
---|---|
Status: | Closed |
Created: | 04/16/2019 |
Points: | 100 |
Expired: | 04/23/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/Ice_Binding
*or*
https://foldit.fandom.com/wiki/Revisiting_puzzle/Antifreeze_Protein
Help prevent frozen fish!