puzzle picture
1656: Revisiting Puzzle 117: Transport Mutant
Status: Closed

Soloists

RankPlayerGroupScorePoints
126HeLa 51 1376  8,8631
127skiller185 51 1376  8,8511
128felixxy 51 1376  8,8451
129Gandook 51 1376  8,8431
130lamoille 51 1376 Anthropic Dreams8,8271
131multaq 51 1376 L'Alliance Francophone8,8271
132JanZizka 51 1376  8,8251
133kadzber73 51 1376  8,7651
134SaNoi 51 1376  8,6961
135marcodabramo 51 1376  8,6481
136mattj256 51 1376  8,6301
137hajtogato 51 1376  8,6101
138Olascoaga 51 1376  8,4751
139Jiarong 51 1376 SHELL8,4641
140RockOn 51 97  8,3761
141mkq 51 1376  8,3641
142memam2018 51 1376 DW 20207,9431
143orie.simpson@gm... 51 1376  7,8821
144cenkonur 51 1376 GENE 4337,8341
14501010011111 51 701 Go Science7,6431
146Samuelferreira8 51 1376  6,4611
147kost1805 51 1376  6,0431
148 bkoep 51 368  1,2881
149peterwashington 51 1376  1,2881
150lauraperi 51 1376  1,2881


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 6 hours 4 min ago. Offline
Joined: 12/27/2012
See also:

https://foldit.fandom.com/wiki/Revisiting_puzzle/Transport_Mutant

Looks like we received a few extra hours on this puzzle.

Also, there's a slight typo in the sequence as shown above, it should be:

mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons