Summary

Name:	1656: Revisiting Puzzle 117: Transport Mutant
Status:	Closed
Created:	04/01/2019
Points:	100
Expired:	04/08/2019 - 23:00
Difficulty:	Novice
Description:	This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: a MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	9,767	100
2	Beta Folders	9,764	77
3	Hun-Magyar Csapat	9,755	58
4	Contenders	9,750	43
5	Gargleblasters	9,745	31

Rank	Player	Group	Score	Points
1	Galaxie 3 5	Anthropic Dreams	9,767	100
2	phi16 6 18	Anthropic Dreams	9,764	97
3	LociOiling 7 2	Beta Folders	9,763	94
4	robgee 8 13	Anthropic Dreams	9,762	91
5	smilingone 171 16015	Beta Folders	9,761	88

Rank	Player	Group	Score	Points
1	LociOiling 7 2	Beta Folders	9,764	100
2	tyler0911 171 16015	Anthropic Dreams	9,761	97
3	grogar7 102 1	Anthropic Dreams	9,758	94
4	O Seki To 84 151	Hun-Magyar Csapat	9,755	91
5	georg137 18 37	Contenders	9,750	88

Need this puzzle? Log in to download.

Mon, 04/01/2019 - 18:13

Offline

Joined: 12/27/2012

Groups: Beta Folders

Looks like we received a few extra hours on this puzzle.

Also, there's a slight typo in the sequence as shown above, it should be:

mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	My new assumption about protein folding Mac control, command, and options keys? (Plus any other hotkey lore....) refinement puzzles Foldit Bot Can we have copies of the proteins?


	Top New Users Tans8b07 kosmo1 BNet DarklinkXD felimare