|
1639: Revisiting Puzzle 110: Turkey
Status: Closed
|
Summary
| Name: | 1639: Revisiting Puzzle 110: Turkey |
|---|---|
| Status: | Closed |
| Created: | 02/20/2019 |
| Points: | 100 |
| Expired: | 02/27/2019 - 18:00 |
| Difficulty: | Novice |
| Description: | This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/Turkey