more time, maybe 6 months
2 weeks
at least 2 weeks
Thank you both for the feedback, we've extended this one by another week.
Sadly we won't be able to extend it for 6 months, though! :-)
this needs no more time I have spent just 10 hours on this....no more time is needed.
2 weeks for a very clear ED is a joke - it only plays to those that have big machines and rely on script work. If I can play this with handwork and have no issues - why are those with big machines given such a ridiculous amount of time to catch up?
i have 2 hours a day to work on foldit, 10 hours the first day---not possible
but U can run a fast machine 24 hrs a day on multiple puzzles regardless - I cannot...be fair michael. U know what I mean.
there isn't a script for electron density, right now i have 1/2 an hour before I have to pick up my granddaughter at school. then its cook dinner for the family. I have a bit of time each morning after I drop her off and then its laundry, shopping and the garden etc.
I agree with you on revisits, and most of the other puzzles. just not ed
I think this puzzle starts with all loops as
its secondary structure. Is that intentional?
However, PSIPRED prediction (bellow) is quite useful to help to fit into the density somewhere (but the density gives a quite different pattern after all)
LLLLLLLLEEEEEEELLLLLLLLEEEEEEEELLLEEEEEEEEEELLLLLEEEELLLLLLLLLEEEEEEELLLL
HHHHHHHHHHLLLLEEEEEEEEEEELLLLLEEEEEEELLEEEEEEEELLLLLLLLEEEEEEEEEEEELEEEEEEEL
copy-paste it in note 19 then run:
https://fold.it/portal/recipe/49556
(and run this recipe every time you want to recover it)
Source for prediction (it takes 30 minutes):
http://bioinf.cs.ucl.ac.uk/psipred/
Thank you. Quick question for Foldit for Dummies: Where do I find note 19?
In Puzzle 1598, if you are in the Original Interface using
the Rainbow color scheme, you can find Note 19 by Tabbing
on the blue end of the protein. A window called "Segment
Information" will appear for the segment you Tabbed on.
You can then use the left or right arrow key to move to
the "Segment Information" window for Isoleucine 19. At the
bottom of this window is a section called "Notes". You can
paste the desired secondary structure (listed above) in the
"Notes" section. The little trash can next to the "Notes"
section clears this section's contents.
Thank you. :)
...or you can use SS Edit 1.2 (recipe 102273)
MSTPAVSHRFLVNFLFNNIPNPFDIAFQRISGLSRTLEVSQHREGGENVRNLWLAEQVNHGSL
VLERGVMNASPLTLQFDRVLRRESTQWANVVIMLLNELSLPVTTWTLSHALPVRWQMGDLDAG
SNQVLINTLELRYQDMRMLGVKL