![]() |
1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
|
Summary
Name: | 1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin |
---|---|
Status: | Closed |
Created: | 07/16/2018 |
Points: | 100 |
Expired: | 07/23/2018 - 17:00 |
Difficulty: | Intermediate |
Description: | This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.wikia.com/wiki/Revisiting_puzzle/Scorpion_toxin