puzzle picture

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Status: Closed

Summary

Name:	1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin
Status:	Closed
Created:	07/16/2018
Points:	100
Expired:	07/23/2018 - 17:00
Difficulty:	Intermediate
Description:	This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else! Sequence: MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	10,888	100
2	Marvin's bunch	10,765	63
3	Go Science	10,737	37
4	Anthropic Dreams	10,638	21
5	Void Crushers	10,634	11

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	LociOiling 2 1	Beta Folders	10,888	100
2	reefyrob 46 1399	Beta Folders	10,864	96
3	retiredmichael 46 1399	Beta Folders	10,846	92
4	dbuske 46 1399	Beta Folders	10,819	87
5	Bruno Kestemont 3 3	Go Science	10,732	83

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	bertro 46 1399	Beta Folders	10,872	100
2	LociOiling 2 1	Beta Folders	10,820	96
3	frood66 46 59	Marvin's bunch	10,765	92
4	fiendish_ghoul 46 25		10,755	87
5	Bruno Kestemont 3 3	Go Science	10,737	83

Show all >

Need this puzzle? Log in to download.

Comments

Tue, 07/17/2018 - 01:50

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Anthropic Dreams

See also:

https://foldit.wikia.com/wiki/Revisiting_puzzle/Scorpion_toxin


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Social Media


	Search Only search fold.it


	Click here to read Foldit's statement on the Black Lives Matter movement.


	Other Games: Mozak

Recommend Foldit


	Topics
	Forums temporarily locked due to spam Happy few Gold players in History Interview with DeepMind's Demis Hassabis timing for "share with scientists"? extend deadline for AlphaFold submissions?


	Top New Users Benjamin_F fracata Zhang Ruichong marto808 SonaKona

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons