puzzle picture
1528: Unsolved De-novo Freestyle 132
Status: Closed

Summary

Name: 1528: Unsolved De-novo Freestyle 132
Status: Closed
Created: 05/31/2018
Points: 100
Expired: 06/07/2018 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,760100
2Beta Folders10,59373
3Anthropic Dreams10,57752
4Go Science10,56536
5L'Alliance Francophone10,49524

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1actiasluna 82 354 Gargleblasters10,760100
2eusair 102 2307  10,62697
3dcrwheeler 102 5  10,60493
4bertro 102 2307 Beta Folders10,58990
5mirp 1 3 Go Science10,56587


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons