puzzle picture
1506: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed

Summary

Name: 1506: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
Created: 04/09/2018
Points: 100
Expired: 04/16/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,156100
2Beta Folders10,13863
3Go Science10,11437
4L'Alliance Francophone10,10021
5Void Crushers9,99511

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1actiasluna 17 14 Gargleblasters10,156100
2dcrwheeler 81 8  10,14497
3bertro 31 29 Beta Folders10,13894
4fiendish_ghoul 81 9  10,12690
5ZeroLeak7 24 2 Go Science10,11287


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons