puzzle picture
1478: Foldit Player Design with Electron Density: Part 2
Status: Closed

Groups



Need this puzzle? Log in to download.  

Comments

jeff101's picture
User offline. Last seen 2 hours 40 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Puzzle 1475 Solutions?

Can we load solutions from puzzle 1475 into puzzle 1478?

bkoep's picture
User offline. Last seen 19 hours 5 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
No

While the correct models for puzzles 1475 and 1478 are likely very similar, they will be distinct.

We want to encourage players to build models directly into this density map, rather than try to force in models that was previously built with another density map.

Joined: 03/30/2013
Groups: Go Science
sequence here for convenience

Sequence:
TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

I am re-posting the amino acid sequence here for the sake of convenience. Will save you a click or two.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons