|
1471: Revisiting Puzzle 147: Rosetta Decoy 10
Status: Closed
|
Summary
| Name: | 1471: Revisiting Puzzle 147: Rosetta Decoy 10 |
|---|---|
| Status: | Closed |
| Created: | 01/16/2018 |
| Points: | 100 |
| Expired: | 01/24/2018 - 18:00 |
| Difficulty: | Intermediate |
| Description: | This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
