![]() |
1459: Revisiting Puzzle 142: Rosetta Decoy 6
Status: Closed
|
Summary
Name: | 1459: Revisiting Puzzle 142: Rosetta Decoy 6 |
---|---|
Status: | Closed |
Created: | 12/11/2017 |
Points: | 100 |
Expired: | 12/19/2017 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.