puzzle picture
1456: Revisiting Puzzle 141: Rosetta Decoy 5
Status: Closed

Summary

Name: 1456: Revisiting Puzzle 141: Rosetta Decoy 5
Status: Closed
Created: 12/03/2017
Points: 100
Expired: 12/10/2017 - 23:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,179100
2Go Science10,12078
3Anthropic Dreams10,09860
4Gargleblasters10,09345
5L'Alliance Francophone10,05533

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 2 2 Beta Folders10,179100
2Bruno Kestemont 5 4 Go Science10,12097
3dcrwheeler 85 7  10,11894
4Enzyme 17 1 Gargleblasters10,09391
5johnmitch 85 10  10,08989


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons