puzzle picture
1452: Unsolved De-novo Freestyle 121
Status: Closed

Summary

Name: 1452: Unsolved De-novo Freestyle 121
Status: Closed
Created: 11/21/2017
Points: 100
Expired: 11/27/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,979100
2Gargleblasters9,89773
3Go Science9,82052
4Marvin's bunch9,80336
5Beta Folders9,75624

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

smilingone's picture
User offline. Last seen 4 hours 31 min ago. Offline
Joined: 09/19/2011
Groups: Beta Folders
Unable to load solution from other team member to evo

I've tried in both an updated and an old client.

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons