puzzle picture
1451: Splicing Factor
Status: Closed

Summary

Name: 1451: Splicing Factor
Status: Closed
Created: 11/17/2017
Points: 100
Expired: 11/21/2017 - 03:00
Difficulty: Intermediate
Description: This protein is involved in transcription regulation and gene expression. It is also associated with both colorectal and liver cancer.
Categories: Experimental

Top Groups

RankGroupScorePoints
1Go Science9,446100
2Anthropic Dreams9,32973
3Gargleblasters9,22052
4Marvin's bunch9,18336
5Contenders9,15824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

frood66's picture
User offline. Last seen 6 hours 6 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
sequence not given - so here it is

GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons