puzzle picture
1444: Unsolved De-novo Freestyle 119
Status: Closed

Summary

Name: 1444: Unsolved De-novo Freestyle 119
Status: Closed
Created: 10/30/2017
Points: 100
Expired: 11/06/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,147100
2Anthropic Dreams10,01278
3Marvin's bunch10,01160
4Beta Folders9,98145
5Gargleblasters9,87933

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Susume's picture
User offline. Last seen 30 min 41 sec ago. Offline
Joined: 10/02/2011
Buried serine?

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons