Summary

Name:	1444: Unsolved De-novo Freestyle 119
Status:	Closed
Created:	10/30/2017
Points:	100
Expired:	11/06/2017 - 23:00
Difficulty:	Intermediate
Description:	The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Sequence: TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,147	100
2	Anthropic Dreams	10,012	78
3	Marvin's bunch	10,011	60
4	Beta Folders	9,981	45
5	Gargleblasters	9,879	33

Rank	Player	Group	Score	Points
1	Hollinas 75 1437	Go Science	10,147	100
2	toshiue 28 187	Go Science	10,145	98
3	Bruno Kestemont 3 3	Go Science	10,145	95
4	ZeroLeak7 35 34	Go Science	10,145	92
5	Azukay 75 1437	Go Science	10,141	89

Rank	Player	Group	Score	Points
1	ZeroLeak7 35 34	Go Science	10,147	100
2	fiendish_ghoul 75 26		10,090	98
3	caglar 75 1437	Go Science	10,089	95
4	isaksson 75 727	Go Science	10,014	92
5	Galaxie 1 2	Anthropic Dreams	10,012	89

Need this puzzle? Log in to download.

Thu, 11/02/2017 - 21:23

Offline

Joined: 10/02/2011

Groups: Anthropic Dreams

Buried serine?

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	Forums temporarily locked due to spam Happy few Gold players in History Interview with DeepMind's Demis Hassabis timing for "share with scientists"? extend deadline for AlphaFold submissions?


	Top New Users zonaldo953 Camma fracata Zhang Ruichong houyi