Summary

Name:	1444: Unsolved De-novo Freestyle 119
Status:	Closed
Created:	10/30/2017
Points:	100
Expired:	11/06/2017 - 23:00
Difficulty:	Intermediate
Description:	The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Sequence: TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,147	100
2	Anthropic Dreams	10,012	78
3	Marvin's bunch	10,011	60
4	Beta Folders	9,981	45
5	Gargleblasters	9,879	33

Rank	Player	Group	Score	Points
1	Hollinas 25 474	Go Science	10,147	100
2	toshiue 10 46	Go Science	10,145	98
3	Bruno Kestemont 3 5	Go Science	10,145	95
4	ZeroLeak7 78 1437	Go Science	10,145	92
5	Azukay 78 1437	Go Science	10,141	89

Rank	Player	Group	Score	Points
1	ZeroLeak7 78 1437	Go Science	10,147	100
2	fiendish_ghoul 78 9		10,090	98
3	caglar 78 1437	Go Science	10,089	95
4	isaksson 78 1437	Go Science	10,014	92
5	Galaxie 1 2	Anthropic Dreams	10,012	89

Need this puzzle? Log in to download.

Thu, 11/02/2017 - 21:23

Offline

Joined: 10/02/2011

Groups: Anthropic Dreams

Buried serine?

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics


	Top New Users mattyg2009 Hero247 HW234 trenz007 pa2040