puzzle picture
1442: Sketchbook Puzzle - Revisiting Puzzle 136
Status: Closed

Summary

Name: 1442: Sketchbook Puzzle - Revisiting Puzzle 136
Status: Closed
Created: 10/20/2017
Points: 100
Expired: 10/27/2017 - 18:00
Difficulty: Intermediate
Description: This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence: ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Categories: Experimental

Top Groups

RankGroupScorePoints
1Go Science8,645100
2Contenders8,64276
3Gargleblasters8,61956
4Hun-Magyar Csapat8,59541
5Anthropic Dreams8,59329

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons