puzzle picture
1423: Unsolved De-novo Freestyle 116: Predicted Contacts
Status: Closed

Summary

Name: 1423: Unsolved De-novo Freestyle 116: Predicted Contacts
Status: Closed
Created: 08/31/2017
Points: 100
Expired: 09/07/2017 - 23:00
Difficulty: Intermediate
Description: This is a follow-up puzzle for Puzzle 1420, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1420 and use them as a starting point here.

Sequence:
MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW
Categories: Overall, Predicted Contacts, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,410100
2Anthropic Dreams10,39277
3Beta Folders10,26958
4Contenders10,03043
5Go Science10,02231

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

toshiue's picture
User offline. Last seen 1 hour 37 min ago. Offline
Joined: 01/31/2016
Groups: None
Shrunke Contact Map

Contact map is suddenly shrunken, currently columns 5 to 60.5, rows 2.5 to 59.

toshiue's picture
User offline. Last seen 1 hour 37 min ago. Offline
Joined: 01/31/2016
Groups: None
Restart

Restarting the client seems to have fixed the shrunken contact map.

bkoep's picture
User offline. Last seen 13 hours 11 min ago. Offline
Joined: 11/15/2012
Groups: None
Weird

Definitely haven't seen that before. Has this happened again? Do you remember what you were doing when the map shrunk?

toshiue's picture
User offline. Last seen 1 hour 37 min ago. Offline
Joined: 01/31/2016
Groups: None
Cause

Was asking myself the same question when I first noticed it. Had been manually picking contacts for some time, then just noticed the edges were missing. No fireworks, just normal one minute and truncated the next. Closing and restarting the client seems to have fixed it (closing/stretching the contact map window had no affect), hasn't re-appeared and is about 500 points on down the line since it happened. Generic weirdness, best guess.

altejoh's picture
User offline. Last seen 20 hours 7 min ago. Offline
Joined: 04/21/2016
Groups: None
Similar problem

Have had a similar problem with all contact map puzzles. It is consistently caused by attempting to scroll to "zoom in" on the contact map, after which zooming out causes it to zoom back in once again. Figured it was another bug for Mac users. Also noticed that simply restarting the client and not scrolling on the contact map resolves the issue.

Susume's picture
User offline. Last seen 3 hours 51 min ago. Offline
Joined: 10/02/2011
Map can be zoomed

The map can be zoomed, using whatever your computer's zoom control is. I wonder if you somehow zoomed in on it. That makes the edges disappear.

jeff101's picture
User offline. Last seen 7 hours 40 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Oops. I made the contact map too big.

I have a different problem on one client:

I made the contact map so tall that the thin bar at its bottom edge that lets you adjust the map's height is no longer clickable. Now I can't seem to shrink this contact map. Not a big problem, but it would be better if it didn't happen.

LociOiling's picture
User offline. Last seen 6 hours 3 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
mouse wheel to zoom, restart for "wedgie"

To expand on susume's answer to toshiue, the mouse wheel zooms the contact map in or out.

When the contact map window gets "wedged", as jeff101 describes, the resize bar is no longer visible. Restarting the client seems to work in this case. After the restart, the contact map starts at a smaller size.

On some systems, you may be able to flip the display, which is another way to resize the window with restarting the client.

For example, on my Thinkpad laptop, ctrl+alt+left arrow flips the display to the top is on the left of the screen. With this tall thin view, it's easy to resize the contact map. Hitting ctrl+alt+up arrow returns the display to its normal orientation.

(Caution: sometimes display flipping (usually by accident) caused a display driver glitch which caused all Foldit clients to crash. This seems to have been fixed, probably on the Windows side, no recent incidents to report on.)

jeff101's picture
User offline. Last seen 7 hours 40 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Loci's trick works!

I just tried the ctrl-alt-left arrow and ctrl-alt-up arrow trick Loci mentioned above. On a Dell Inspiron Windows 7 laptop, this trick let me rotate by 90 degrees an Internet Explorer window as well as a Foldit client window. In the rotated Foldit window, moving my mouse forward made the cursor move to the left, but I got used to this. I was able to shrink the enlarged Contact Map in this Foldit client without restarting the client, as desired.

Thanks!

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons