puzzle picture
1415: Revisiting Puzzle 136: Cell Adhesion
Status: Closed

Summary

Name: 1415: Revisiting Puzzle 136: Cell Adhesion
Status: Closed
Created: 08/10/2017
Points: 100
Expired: 08/17/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,570100
2Gargleblasters9,56068
3Anthropic Dreams9,48944
4Void Crushers9,47627
5Beta Folders9,45816

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Glen B 85 19  9,824100
2gitwut 57 61 Contenders9,57097
3Enzyme 17 1 Gargleblasters9,55193
4eusair 85 12  9,49390
5markm457 85 16 Anthropic Dreams9,48986


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons