puzzle picture
1414: Unsolved De-novo 114
Status: Closed

Summary

Name: 1414: Unsolved De-novo 114
Status: Closed
Created: 08/09/2017
Points: 100
Expired: 08/16/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,608100
2Beta Folders9,59676
3Go Science9,46856
4Marvin's bunch9,44541
5L'Alliance Francophone9,43929

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

gitwut's picture
User offline. Last seen 45 min 42 sec ago. Offline
Joined: 05/18/2012
Groups: Contenders
IRC

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons