puzzle picture
1411: Unsolved De-novo Freestyle 113
Status: Closed

Summary

Name: 1411: Unsolved De-novo Freestyle 113
Status: Closed
Created: 08/01/2017
Points: 100
Expired: 08/08/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
ETRERMEKWVEEVLRRIEEIIKKVTDKEQIEKEIRKLEKELRERIRQEDENSRLNIDVQIDQQDNHDEMRVEIRVELDGHEIRRRINVTK
Categories: Design, Overall

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,932100
2Gargleblasters9,92476
3Beta Folders9,88956
4Go Science9,79441
5Marvin's bunch9,78529

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Susume's picture
User offline. Last seen 2 hours 51 min ago. Offline
Joined: 10/02/2011
Let us mutate just a few

This puzzle is an example where letting us mutate just a few (like maybe 3) residues (of our choosing) might result in an even more stable fold. For example, residues 82-86 IRRRI - 2 oranges separated by 3 blues - make psipred think the final structure is a helix. They might make it fold as a helix too. But I'd be willing to bet it was designed as a sheet. Substituting an orange for the middle R would convince psipred that it was a sheet, and might make it actually fold into a sheet more reliably than the given sequence does.

You could give us the protein with a few mutations allowed as a separate puzzle, if you don't want to mess up the results of whatever experiment you are currently doing with us predicting foldit designs.

You could find any solutions that resemble the original design, run those mutated sequences through Rosetta, and compare the results using only backbone atoms to the original design, to see if you get better funnel-shaped graphs.

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons