puzzle picture
1409: Revisiting Puzzle 135: E. coli
Status: Closed

Summary

Name: 1409: Revisiting Puzzle 135: E. coli
Status: Closed
Created: 07/27/2017
Points: 100
Expired: 08/03/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams8,926100
2Beta Folders8,92177
3Go Science8,90558
4Contenders8,88943
5Marvin's bunch8,85531

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons