puzzle picture
1406: Revisiting Puzzle 134: Rice
Status: Closed

Summary

Name: 1406: Revisiting Puzzle 134: Rice
Status: Closed
Created: 07/20/2017
Points: 100
Expired: 07/27/2017 - 23:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,996100
2Go Science9,99278
3Beta Folders9,96360
4Gargleblasters9,94645
5Anthropic Dreams9,93633

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons