puzzle picture
1403: Revisiting Puzzle 126: Ethanolamine Utilization
Status: Closed

Summary

Name: 1403: Revisiting Puzzle 126: Ethanolamine Utilization
Status: Closed
Created: 07/12/2017
Points: 100
Expired: 07/20/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,313100
2Go Science9,27173
3Contenders9,26952
4Anthropic Dreams9,21736
5Gargleblasters9,21124

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Enzyme 28 17  9,289100
2caglar 77 18 Go Science9,27197
3gitwut 21 11 Contenders9,26994
4ZeroLeak7 36 9 Go Science9,26091
5Bruno Kestemont 6 8 Go Science9,24988


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Supported by: UW Center for Game Science, UW Department of Computer Science and Engineering, UW Baker Lab, VU Meiler Lab,
DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons