puzzle picture
1400: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed

Summary

Name: 1400: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed
Created: 07/06/2017
Points: 100
Expired: 07/13/2017 - 23:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Hun-Magyar Csapat9,026100
2Contenders9,02174
3Go Science9,01454
4Beta Folders9,01338
5Anthropic Dreams9,00027

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons