puzzle picture
1397: Revisiting Puzzle 124: PDZ Domain
Status: Closed

Summary

Name: 1397: Revisiting Puzzle 124: PDZ Domain
Status: Closed
Created: 06/29/2017
Points: 100
Expired: 07/06/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,469100
2Anthropic Dreams9,43676
3Contenders9,41256
4Gargleblasters9,40941
5Void Crushers9,39429

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1eusair 81 13  9,461100
2Galaxie 1 3 Anthropic Dreams9,43697
3dcrwheeler 81 7  9,42794
4actiasluna 7 8 Gargleblasters9,40891
5Waya 18 37 Anthropic Dreams9,39788


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons