puzzle picture
1387: Unsolved De-novo Freestyle 106
Status: Closed

Summary

Name: 1387: Unsolved De-novo Freestyle 106
Status: Closed
Created: 06/06/2017
Points: 100
Expired: 06/13/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,758100
2Gargleblasters9,73174
3Beta Folders9,73054
4Anthropic Dreams9,72138
5Contenders9,67827

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Wilm 81 360 Go Science9,737100
2anthion 56 31 Gargleblasters9,73197
3eusair 81 11  9,73194
4LociOiling 2 2 Beta Folders9,72891
5fiendish_ghoul 81 10  9,71688


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons