1379: Revisiting Puzzle 111: Mouse Status: Active

Summary

Name:	1379: Revisiting Puzzle 111: Mouse
Status:	Active
Created:	05/18/2017
Points:	100
Expires:	05/25/2017 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Categories:	Overall, Prediction

Top Groups

Top Evolvers

Top Soloists

Need this puzzle? Log in to download.  

Comments

No comments yet.