|
1376: Revisiting Puzzle 110: Turkey
Status: Closed
|
Summary
| Name: | 1376: Revisiting Puzzle 110: Turkey |
|---|---|
| Status: | Closed |
| Created: | 05/11/2017 |
| Points: | 100 |
| Expired: | 05/18/2017 - 18:00 |
| Difficulty: | Intermediate |
| Description: | This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
In game scoreboards not agreeing with puzzle page scores... again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).