Contest Info

Name: 3V1A
Owner: Bruno Kestemont
Start Date: 04/23/17
End Date: 05/23/17
Puzzle: Freestyle Design: Variable Length
Description:

First set length to 48.
Then mutate to:
GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
using recipe: http://fold.it/portal/recipe/38147

then never mutate and try to find the best score (if you mutated by mistake using a recipe, please ask me to delete you in PM and start again).

SS prediction: LLLHHHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHHHHL

GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
Length: 48 Residues
SS: LLLHHHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHHHHL

code to join the contest:
http://fold.it/portal/smartlogin?destination=addcontestant/3af073d0aa1d6505afcec3c65d875790


Registered Contestants

UserScoresort icon
smholst9050
bendbob8922
Kantorowski8764
tokens8626
Keresto8503
Bruno Kestemont8487
bigcode7923
ashok6839
ZeroLeak70

Registered Groups

Groupsort iconScore
Anthropic Dreams8922
Gargleblasters9050
Go Science8487



Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons