puzzle picture
1366b: Electron Density Practice: Cell Surface Marker
Status: Closed

Summary

Name: 1366b: Electron Density Practice: Cell Surface Marker
Status: Closed
Created: 04/15/2017
Points: 100
Expired: 04/21/2017 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle replaces Puzzle 1366, which was originally posted with an incorrect sequence.

This puzzle is meant for Foldit players to practice folding a protein with an electron density map. This electron density map was generated from x-ray diffraction at a resolution of 1.7 Å, and was published in March of 2017. The protein is only a portion of a much larger protein that is displayed on the surface of human dendritic cells, and plays an important role in the immune system. This protein includes two cysteines that oxidize to form one disulfide bond. Note that part of this protein is "disordered" in the original crystal structure; not all residues will fit into the density! Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVT
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders14,003100
2Contenders13,99274
3Go Science13,96854
4Anthropic Dreams13,95238
5Gargleblasters13,88227

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1gitwut 10 7 Contenders13,990100
2Wilm 62 38 Go Science13,96897
3fiendish_ghoul 84 13  13,96694
4bertro 24 11 Beta Folders13,96292
5markm457 84 1 Anthropic Dreams13,95289


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Supported by: UW Center for Game Science, UW Department of Computer Science and Engineering, UW Baker Lab, VU Meiler Lab,
DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons