Contest Info

Name: Test 3V1A
Type: Template
Owner: Scopper
Start Date: 03/02/17
End Date: 05/02/17
Puzzle: Freestyle Design: Variable Length
Description:

Sequence: GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD
Length: 48 Residues
SS: LLLHHHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHHHHL


Registered Contestants

UserScoresort icon
Scopper8293

Registered Groups

Groupsort iconScore
Go Science8293





Contest List
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons