1337: Revisiting Puzzle 87: Zinc Binding Protein

Status: Closed

Summary

Name:	1337: Revisiting Puzzle 87: Zinc Binding Protein
Status:	Closed
Created:	02/02/2017
Points:	100
Expired:	02/10/2017 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	8,571	100
2	Go Science	8,548	77
3	Gargleblasters	8,522	58
4	Contenders	8,521	43
5	Beta Folders	8,479	31

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	Galaxie 2 6	Anthropic Dreams	8,571	100
2	hansvandenhof 154 162	Anthropic Dreams	8,560	98
3	lamoille 164 15516	Anthropic Dreams	8,556	95
4	ZeroLeak7 21 1	Go Science	8,548	92
5	Bruno Kestemont 3 2	Go Science	8,548	90

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	Galaxie 2 6	Anthropic Dreams	8,570	100
2	toshiue 36 221	Go Science	8,548	98
3	ZeroLeak7 21 1	Go Science	8,543	95
4	markm457 164 15516	Anthropic Dreams	8,537	92
5	Bruno Kestemont 3 2	Go Science	8,526	90

Show all >

Need this puzzle? Log in to download.

Comments

Fri, 02/03/2017 - 23:11

gitwut 164 15516

Offline

Joined: 05/18/2012

Groups: Contenders

Puzzle not showing in client puzzle menu

This puzzle is not showing up for me in the puzzle menu of newly opened clients.

Sat, 02/04/2017 - 18:24

Bruno Kestemont 3 2

Offline

Joined: 09/24/2012

Groups: Go Science

same for me

Only on puzzle page. It's a recurrent problem, see feedback.

Sat, 02/04/2017 - 19:38

frood66 164 54

Offline

Joined: 09/20/2011

Groups: Marvin's bunch

same (of course)

and it certainly is recurrent.

I wonder how many times the same issue has to appear B4 the fix is done when the puzzle is posted.

Even when the puzzle is posted late.

Sun, 02/05/2017 - 03:17

Skippysk8s 29 42

Offline

Joined: 06/06/2013

Groups: Gargleblasters

weekend special :)

glad we have the same weekend special again. Can we have a new one next weekend please. Only good thing is that I will be top 10 on 1335 this weekend LOL. Also, totally unranked on 1337.

Sun, 02/05/2017 - 18:02

Bruno Kestemont 3 2

Offline

Joined: 09/24/2012

Groups: Go Science

Would it be different with ligand?

I just wonder if the solution would be differeny if we had the zinc ligand inside of the puzzle

Sun, 02/05/2017 - 22:26

Skippysk8s 29 42

Offline

Joined: 06/06/2013

Groups: Gargleblasters

re missing ligand

Bruno -- of course it would be different. Question right now is do you want points or a science answer. Your recipe works fine

Mon, 02/06/2017 - 15:51

Bruno Kestemont 3 2

Offline

Joined: 09/24/2012

Groups: Go Science

Disordered protein in context

This is like a semi-disordered protein.
Reading this paper in Forum (http://fold.it/portal/node/2003337) I'm wondering if we would have more chance to find (with Foldit points) a better possible "structure" if the context (molecule or other protein) were given.
May be a question for Science Chat instead.

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	Is FoldIt free software / open source? When will FoldIt go out of Beta? Anti-ageing protein - would it make a good foldit puzzle? Designing Square Barrels: feature request: numbered segments view and more


	Top New Users bjy0700 MMAX MAX banana132 anterio manf

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons