puzzle picture
1337: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed

Summary

Name: 1337: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed
Created: 02/02/2017
Points: 100
Expired: 02/10/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams8,571100
2Go Science8,54877
3Gargleblasters8,52258
4Contenders8,52143
5Beta Folders8,47931
Show all >

Top Evolvers

RankPlayerGroupScorePoints
1Galaxie 2 6 Anthropic Dreams8,571100
2hansvandenhof 72 166 Anthropic Dreams8,56098
3lamoille 6 446 Anthropic Dreams8,55695
4ZeroLeak7 24 2 Go Science8,54892
5Bruno Kestemont 4 4 Go Science8,54890
Show all >

Top Soloists

RankPlayerGroupScorePoints
1Galaxie 2 6 Anthropic Dreams8,570100
2toshiue 3 43 Go Science8,54898
3ZeroLeak7 24 2 Go Science8,54395
4markm457 81 2367 Anthropic Dreams8,53792
5Bruno Kestemont 4 4 Go Science8,52690
Show all >


Need this puzzle? Log in to download.  

Comments

Fri, 02/03/2017 - 23:11
#1
gitwut 81 2367
gitwut's picture
User offline. Last seen 3 weeks 2 days ago. Offline
Joined: 05/18/2012
Groups: Contenders
Puzzle not showing in client puzzle menu

This puzzle is not showing up for me in the puzzle menu of newly opened clients.

Top
Sat, 02/04/2017 - 18:24
#2
Bruno Kestemont 4 4
Bruno Kestemont's picture
User offline. Last seen 15 hours 4 min ago. Offline
Joined: 09/24/2012
Groups: Go Science
same for me

Only on puzzle page. It's a recurrent problem, see feedback.

Top
Sat, 02/04/2017 - 19:38
#3
frood66 81 19
frood66's picture
User offline. Last seen 5 hours 10 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
same (of course)

and it certainly is recurrent.

I wonder how many times the same issue has to appear B4 the fix is done when the puzzle is posted.

Even when the puzzle is posted late.

Top
Sun, 02/05/2017 - 03:17
#4
Skippysk8s 14 18
Skippysk8s's picture
User offline. Last seen 6 hours 45 min ago. Offline
Joined: 06/06/2013
Groups: Gargleblasters
weekend special :)

glad we have the same weekend special again. Can we have a new one next weekend please. Only good thing is that I will be top 10 on 1335 this weekend LOL. Also, totally unranked on 1337.

Top
Sun, 02/05/2017 - 18:02
#5
Bruno Kestemont 4 4
Bruno Kestemont's picture
User offline. Last seen 15 hours 4 min ago. Offline
Joined: 09/24/2012
Groups: Go Science
Would it be different with ligand?

I just wonder if the solution would be differeny if we had the zinc ligand inside of the puzzle

Top
Sun, 02/05/2017 - 22:26
#6
Skippysk8s 14 18
Skippysk8s's picture
User offline. Last seen 6 hours 45 min ago. Offline
Joined: 06/06/2013
Groups: Gargleblasters
re missing ligand

Bruno -- of course it would be different. Question right now is do you want points or a science answer. Your recipe works fine

Top
Mon, 02/06/2017 - 15:51
#7
Bruno Kestemont 4 4
Bruno Kestemont's picture
User offline. Last seen 15 hours 4 min ago. Offline
Joined: 09/24/2012
Groups: Go Science
Disordered protein in context

This is like a semi-disordered protein.
Reading this paper in Forum (http://fold.it/portal/node/2003337) I'm wondering if we would have more chance to find (with Foldit points) a better possible "structure" if the context (molecule or other protein) were given.
May be a question for Science Chat instead.

Top
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons