puzzle picture
1324: Revisiting Puzzle 83: Cardiotoxin
Status: Closed

Summary

Name: 1324: Revisiting Puzzle 83: Cardiotoxin
Status: Closed
Created: 01/04/2017
Points: 100
Expired: 01/11/2017 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,624100
2Beta Folders9,62373
3Anthropic Dreams9,59852
4L'Alliance Francophone9,58136
5Go Science9,57824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 06/24/2008
Groups: Void Crushers
Fliters

The filter seems to be toggling off when I do anything manually

gitwut's picture
User offline. Last seen 4 hours 37 min ago. Offline
Joined: 05/18/2012
Groups: Contenders
Same as puzzle 1320

This is the same puzzle we just finished (1320)

bertro's picture
User offline. Last seen 13 hours 19 min ago. Offline
Joined: 05/02/2011
Groups: Beta Folders
The chains are a bit

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Supported by: UW Center for Game Science, UW Department of Computer Science and Engineering, UW Baker Lab, VU Meiler Lab,
DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons