puzzle picture
1323: Unsolved De-novo Freestyle 94
Status: Closed

Summary

Name: 1323: Unsolved De-novo Freestyle 94
Status: Closed
Created: 12/30/2016
Points: 100
Expired: 01/06/2017 - 23:00
Difficulty: Intermediate
Description: The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,647100
2Beta Folders9,60171
3Anthropic Dreams9,58049
4Go Science9,57333
5Void Crushers9,50222

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1fiendish_ghoul 83 12  9,759100
2gitwut 9 6 Contenders9,64797
3bertro 25 10 Beta Folders9,59394
4Z7ro 35 7 Go Science9,57391
5tokens 52 3 Anthropic Dreams9,57389


Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Supported by: UW Center for Game Science, UW Department of Computer Science and Engineering, UW Baker Lab, VU Meiler Lab,
DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons