puzzle picture
1300: Revisiting Puzzle 75 with Density: Antifreeze Protein
Status: Closed

Summary

Name: 1300: Revisiting Puzzle 75 with Density: Antifreeze Protein
Status: Closed
Created: 10/25/2016
Points: 100
Expired: 11/02/2016 - 18:00
Difficulty: Intermediate
Description: This is a repost of Puzzle 1298, now with an electron density map! This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1298.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams12,710100
2Go Science12,70680
3Beta Folders12,70563
4Gargleblasters12,70049
5Contenders12,70037

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(Vista/7/8)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons